Lineage for d2phlb2 (2phl B:220-381)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63617Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)
  4. 63618Superfamily b.82.1: RmlC-like [51182] (4 families) (S)
  5. 63629Family b.82.1.2: Germin/Seed storage 7S protein [51187] (2 proteins)
  6. 63633Protein Seed storage 7S protein [51188] (2 species)
  7. 63634Species French bean (Phaseolus vulgaris), phaseolin [TaxId:3885] [51189] (2 PDB entries)
  8. 63638Domain d2phlb2: 2phl B:220-381 [28085]

Details for d2phlb2

PDB Entry: 2phl (more details), 2.2 Å

PDB Description: the structure of phaseolin at 2.2 angstroms resolution: implications for a common vicilin(slash)legumin structure and the genetic engineering of seed storage proteins

SCOP Domain Sequences for d2phlb2:

Sequence, based on SEQRES records: (download)

>d2phlb2 b.82.1.2 (B:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin}
ntignefgnltertdnslnvlissiemeegalfvphyyskaivilvvnegeahvelvgpk
gnketleyesyraelskddvfvipaaypvaikatsnvnftgfginannnnrnllagktdn
vissigraldgkdvlgltfsgsgdevmklinkqsgsyfvdah

Sequence, based on observed residues (ATOM records): (download)

>d2phlb2 b.82.1.2 (B:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin}
ntignefgnltertdnslnvlissiemeegalfvphyyskaivilvvnegeahvelvgpk
getleyesyraelskddvfvipaaypvaikatsnvnftgfginannnnrnllagktdnvi
ssigraldgkdvlgltfsgsgdevmklinkqsgsyfvdah

SCOP Domain Coordinates for d2phlb2:

Click to download the PDB-style file with coordinates for d2phlb2.
(The format of our PDB-style files is described here.)

Timeline for d2phlb2: