Lineage for d2phlb2 (2phl B:220-381)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814551Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2814575Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 2814576Species French bean (Phaseolus vulgaris), phaseolin [TaxId:3885] [51189] (2 PDB entries)
  8. 2814580Domain d2phlb2: 2phl B:220-381 [28085]
    complexed with nag, po4

Details for d2phlb2

PDB Entry: 2phl (more details), 2.2 Å

PDB Description: the structure of phaseolin at 2.2 angstroms resolution: implications for a common vicilin(slash)legumin structure and the genetic engineering of seed storage proteins
PDB Compounds: (B:) phaseolin

SCOPe Domain Sequences for d2phlb2:

Sequence, based on SEQRES records: (download)

>d2phlb2 b.82.1.2 (B:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]}
ntignefgnltertdnslnvlissiemeegalfvphyyskaivilvvnegeahvelvgpk
gnketleyesyraelskddvfvipaaypvaikatsnvnftgfginannnnrnllagktdn
vissigraldgkdvlgltfsgsgdevmklinkqsgsyfvdah

Sequence, based on observed residues (ATOM records): (download)

>d2phlb2 b.82.1.2 (B:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]}
ntignefgnltertdnslnvlissiemeegalfvphyyskaivilvvnegeahvelvgpk
getleyesyraelskddvfvipaaypvaikatsnvnftgfginannnnrnllagktdnvi
ssigraldgkdvlgltfsgsgdevmklinkqsgsyfvdah

SCOPe Domain Coordinates for d2phlb2:

Click to download the PDB-style file with coordinates for d2phlb2.
(The format of our PDB-style files is described here.)

Timeline for d2phlb2: