SCOP 1.73: Domain d2phlb1: 2phl B:11-210

Lineage for d2phlb1 (2phl B:11-210)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (20 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)

6. Protein Seed storage 7S protein [51188] (6 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species French bean (Phaseolus vulgaris), phaseolin [TaxId:3885] [51189] (2 PDB entries)

8. Domain d2phlb1: 2phl B:11-210 [28084]

Details for d2phlb1

PDB Entry: 2phl, 2.2 Å

PDB Description: the structure of phaseolin at 2.2 angstroms resolution: implications for a common vicilin(slash)legumin structure and the genetic engineering of seed storage proteins

PDB Compounds: (B:) phaseolin

SCOP Domain Sequences for d2phlb1:

Sequence; same for both SEQRES and ATOM records:

>d2phlb1 b.82.1.2 (B:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]}
dnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrskpetlllpqqa
daelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifylvnpdpkedlr
iiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrvlfeeegqqeg
vivnidseqikelskhakss

Timeline for d2phlb1:

• d2phlb1 first appeared (with stable ids) in SCOP 1.55
  
• d2phlb1 appears in SCOP 1.71
  
• d2phlb1 appears in SCOP 1.75
  
• d2phlb1 appears in the current release, SCOPe 2.08