Lineage for d2phlb1 (2phl B:11-210)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17821Fold b.82: Double-stranded beta-helix [51181] (5 superfamilies)
  4. 17822Superfamily b.82.1: RmlC-like [51182] (4 families) (S)
  5. 17833Family b.82.1.2: Germin/Seed storage 7S protein [51187] (1 protein)
  6. 17834Protein Seed storage 7S protein [51188] (2 species)
  7. 17835Species French bean (Phaseolus vulgaris), phaseolin [TaxId:3885] [51189] (2 PDB entries)
  8. 17838Domain d2phlb1: 2phl B:11-210 [28084]

Details for d2phlb1

PDB Entry: 2phl (more details), 2.2 Å

PDB Description: the structure of phaseolin at 2.2 angstroms resolution: implications for a common vicilin(slash)legumin structure and the genetic engineering of seed storage proteins

SCOP Domain Sequences for d2phlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2phlb1 b.82.1.2 (B:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin}
dnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrskpetlllpqqa
daelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifylvnpdpkedlr
iiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrvlfeeegqqeg
vivnidseqikelskhakss

SCOP Domain Coordinates for d2phlb1:

Click to download the PDB-style file with coordinates for d2phlb1.
(The format of our PDB-style files is described here.)

Timeline for d2phlb1: