SCOP 1.75: Domain d2phla2: 2phl A:220-381

Lineage for d2phla2 (2phl A:220-381)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (24 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)

6. Protein Seed storage 7S protein [51188] (6 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species French bean (Phaseolus vulgaris), phaseolin [TaxId:3885] [51189] (2 PDB entries)

8. Domain d2phla2: 2phl A:220-381 [28083]

Details for d2phla2

PDB Entry: 2phl, 2.2 Å

PDB Description: the structure of phaseolin at 2.2 angstroms resolution: implications for a common vicilin(slash)legumin structure and the genetic engineering of seed storage proteins

PDB Compounds: (A:) phaseolin

SCOP Domain Sequences for d2phla2:

Sequence, based on SEQRES records:

>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]}
ntignefgnltertdnslnvlissiemeegalfvphyyskaivilvvnegeahvelvgpk
gnketleyesyraelskddvfvipaaypvaikatsnvnftgfginannnnrnllagktdn
vissigraldgkdvlgltfsgsgdevmklinkqsgsyfvdah

Sequence, based on observed residues (ATOM records):

>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]}
ntignefgnltertdnslnvlissiemeegalfvphyyskaivilvvnegeahvelvgpk
getleyesyraelskddvfvipaaypvaikatsnvnftgfginannnnrnllagktdnvi
ssigraldgkdvlgltfsgsgdevmklinkqsgsyfvdah

Timeline for d2phla2:

• d2phla2 first appeared (with stable ids) in SCOP 1.55
  
• d2phla2 appears in SCOP 1.73
  
• d2phla2 appears in SCOPe 2.01
  
• d2phla2 appears in the current release, SCOPe 2.08