SCOP 1.61: Domain d2phla1: 2phl A:11-210

Lineage for d2phla1 (2phl A:11-210)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)

4. Superfamily b.82.1: RmlC-like cupins [51182] (5 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)

6. Protein Seed storage 7S protein [51188] (4 species)

7. Species French bean (Phaseolus vulgaris), phaseolin [TaxId:3885] [51189] (2 PDB entries)

8. Domain d2phla1: 2phl A:11-210 [28082]

Details for d2phla1

PDB Entry: 2phl, 2.2 Å

PDB Description: the structure of phaseolin at 2.2 angstroms resolution: implications for a common vicilin(slash)legumin structure and the genetic engineering of seed storage proteins

SCOP Domain Sequences for d2phla1:

Sequence; same for both SEQRES and ATOM records:

>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin}
dnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrskpetlllpqqa
daelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifylvnpdpkedlr
iiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrvlfeeegqqeg
vivnidseqikelskhakss

Timeline for d2phla1:

• d2phla1 first appeared (with stable ids) in SCOP 1.55
  
• d2phla1 appears in SCOP 1.59
  
• d2phla1 appears in SCOP 1.63
  
• d2phla1 appears in the current release, SCOPe 2.08