Lineage for d1epza_ (1epz A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2423916Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)
  6. 2423917Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species)
    synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase
  7. 2423918Species Methanobacterium thermoautotrophicum [TaxId:145262] [51186] (2 PDB entries)
  8. 2423920Domain d1epza_: 1epz A: [28081]
    complexed with tyd

Details for d1epza_

PDB Entry: 1epz (more details), 1.75 Å

PDB Description: crystal structure of dtdp-6-deoxy-d-xylo-4-hexuloase 3,5-epimerase from methanobacterium thermoautotrophicum with bound ligand.
PDB Compounds: (A:) dtdp-6-deoxy-d-xylo-4-hexulose 3,5-epimerase

SCOPe Domain Sequences for d1epza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1epza_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Methanobacterium thermoautotrophicum [TaxId: 145262]}
efrfiktsldgaiiiepevytdergyfmetfneaifqenglevrfvqdnesmsvrgvlrg
lhfqrekpqgklvrvirgeifdvavdlrknsdtygewtgvrlsdenrreffipegfahgf
lalsdecivnykctelyhpeydsgipwddpdigidwplemvddliisekdrnwkplrenp
vyl

SCOPe Domain Coordinates for d1epza_:

Click to download the PDB-style file with coordinates for d1epza_.
(The format of our PDB-style files is described here.)

Timeline for d1epza_: