Lineage for d1dzra_ (1dzr A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2423916Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)
  6. 2423917Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species)
    synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase
  7. 2423938Species Salmonella typhimurium [TaxId:90371] [51185] (2 PDB entries)
  8. 2423941Domain d1dzra_: 1dzr A: [28076]
    complexed with gol, so4

Details for d1dzra_

PDB Entry: 1dzr (more details), 2.17 Å

PDB Description: rmlc from salmonella typhimurium
PDB Compounds: (A:) dtdp-4-dehydrorhamnose 3,5-epimerase

SCOPe Domain Sequences for d1dzra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]}
mmiviktaipdvlilepkvfgdergfffesynqqtfeeligrkvtfvqdnhskskknvlr
glhfqrgenaqgklvrcavgevfdvavdirkesptfgqwvgvnlsaenkrqlwipegfah
gfvtlseyaeflykatnyyspssegsilwndeaigiewpfsqlpelsakdaaaplldqal
lte

SCOPe Domain Coordinates for d1dzra_:

Click to download the PDB-style file with coordinates for d1dzra_.
(The format of our PDB-style files is described here.)

Timeline for d1dzra_: