SCOPe 2.05: Domain d1dzra_: 1dzr A:

Lineage for d1dzra_ (1dzr A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)

6. Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species)
   synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase

7. Species Salmonella typhimurium [TaxId:90371] [51185] (2 PDB entries)

8. Domain d1dzra_: 1dzr A: [28076]
   complexed with gol, so4

Details for d1dzra_

PDB Entry: 1dzr, 2.17 Å

PDB Description: rmlc from salmonella typhimurium

PDB Compounds: (A:) dtdp-4-dehydrorhamnose 3,5-epimerase

SCOPe Domain Sequences for d1dzra_:

Sequence; same for both SEQRES and ATOM records:

>d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]}
mmiviktaipdvlilepkvfgdergfffesynqqtfeeligrkvtfvqdnhskskknvlr
glhfqrgenaqgklvrcavgevfdvavdirkesptfgqwvgvnlsaenkrqlwipegfah
gfvtlseyaeflykatnyyspssegsilwndeaigiewpfsqlpelsakdaaaplldqal
lte

Timeline for d1dzra_:

• d1dzra_ first appeared (with stable ids) in SCOP 1.55
  
• d1dzra_ appears in SCOPe 2.04
  
• d1dzra_ appears in SCOPe 2.06
  
• d1dzra_ appears in the current release, SCOPe 2.08