SCOP 1.75: Domain d1qq0a_: 1qq0 A:

Lineage for d1qq0a_ (1qq0 A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (8 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.5: gamma-carbonic anhydrase-like [51174] (3 proteins)
   archaeal hexapeptide repeat proteins
   this is a repeat family; one repeat unit is 1v3w A:71-88 found in domain

6. Protein gamma-carbonic anhydrase [51175] (1 species)

7. Species Archaeon Methanosarcina thermophila [TaxId:2210] [51176] (7 PDB entries)

8. Domain d1qq0a_: 1qq0 A: [28069]
   complexed with ocm

Details for d1qq0a_

PDB Entry: 1qq0, 1.76 Å

PDB Description: cobalt substituted carbonic anhydrase from methanosarcina thermophila

PDB Compounds: (A:) carbonic anhydrase

SCOP Domain Sequences for d1qq0a_:

Sequence; same for both SEQRES and ATOM records:

>d1qq0a_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]}
defsnirenpvtpwnpepsapvidptayidpqasvigevtiganvmvspmasirsdegmp
ifvgdrsnvqdgvvlhaletineegepiednivevdgkeyavyignnvslahqsqvhgpa
avgddtfigmqafvfkskvgnncvleprsaaigvtipdgryipagmvvtsqaeadklpev
tddyayshtneavvyvnvhlaegykets

Timeline for d1qq0a_:

• d1qq0a_ first appeared (with stable ids) in SCOP 1.55
  
• d1qq0a_ appears in SCOP 1.73
  
• d1qq0a_ appears in SCOPe 2.01
  
• d1qq0a_ appears in the current release, SCOPe 2.08