| Class b: All beta proteins [48724] (178 folds) |
| Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) ![]() superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
| Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins) this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain |
| Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51172] (3 species) |
| Species Escherichia coli [TaxId:562] [51173] (6 PDB entries) |
| Domain d1fwya1: 1fwy A:252-328 [28064] Other proteins in same PDB: d1fwya2, d1fwyb2 truncated form after R331 complexed with edo, so4, ud1 |
PDB Entry: 1fwy (more details), 2.3 Å
SCOPe Domain Sequences for d1fwya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fwya1 b.81.1.4 (A:252-328) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]}
vmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsvigddceisp
ytvvedanlaaactigp
Timeline for d1fwya1: