![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.81: Single-stranded left-handed beta-helix [51160] (2 superfamilies) superhelix with each turn made by 3 strands with short links |
![]() | Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (5 families) ![]() duplication: the sequence hexapeptide repeats correspond to individual strands |
![]() | Family b.81.1.4: N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51171] (1 protein) this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain |
![]() | Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51172] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [51173] (3 PDB entries) |
![]() | Domain d1fwya1: 1fwy A:252-328 [28064] Other proteins in same PDB: d1fwya2, d1fwyb2 |
PDB Entry: 1fwy (more details), 2.3 Å
SCOP Domain Sequences for d1fwya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fwya1 b.81.1.4 (A:252-328) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli} vmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsvigddceisp ytvvedanlaaactigp
Timeline for d1fwya1: