Lineage for d1fwya1 (1fwy A:252-328)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63569Fold b.81: Single-stranded left-handed beta-helix [51160] (2 superfamilies)
  4. 63570Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (5 families) (S)
  5. 63588Family b.81.1.4: N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51171] (1 protein)
    this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain
  6. 63589Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51172] (2 species)
  7. 63590Species Escherichia coli [TaxId:562] [51173] (3 PDB entries)
  8. 63595Domain d1fwya1: 1fwy A:252-328 [28064]
    Other proteins in same PDB: d1fwya2, d1fwyb2

Details for d1fwya1

PDB Entry: 1fwy (more details), 2.3 Å

PDB Description: crystal structure of n-acetylglucosamine 1-phosphate uridyltransferase bound to udp-glcnac

SCOP Domain Sequences for d1fwya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwya1 b.81.1.4 (A:252-328) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli}
vmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsvigddceisp
ytvvedanlaaactigp

SCOP Domain Coordinates for d1fwya1:

Click to download the PDB-style file with coordinates for d1fwya1.
(The format of our PDB-style files is described here.)

Timeline for d1fwya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fwya2