SCOP 1.71: Domain d1fxja1: 1fxj A:252-329

Lineage for d1fxja1 (1fxj A:252-329)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (3 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (6 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.4: N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51171] (1 protein)
   this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain

6. Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51172] (2 species)

7. Species Escherichia coli [TaxId:562] [51173] (3 PDB entries)

8. Domain d1fxja1: 1fxj A:252-329 [28062]
   Other proteins in same PDB: d1fxja2, d1fxjb2

Details for d1fxja1

PDB Entry: 1fxj, 2.25 Å

PDB Description: crystal structure of n-acetylglucosamine 1-phosphate uridyltransferase

SCOP Domain Sequences for d1fxja1:

Sequence; same for both SEQRES and ATOM records:

>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli}
vmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsvigddceisp
ytvvedanlaaactigpf

Timeline for d1fxja1:

• d1fxja1 first appeared (with stable ids) in SCOP 1.55
  
• d1fxja1 appears in SCOP 1.69
  
• d1fxja1 appears in SCOP 1.73
  
• d1fxja1 appears in the current release, SCOPe 2.08