Class b: All beta proteins [48724] (174 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.4: GlmU C-terminal domain-like [51171] (3 proteins) this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain |
Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51172] (2 species) |
Species Escherichia coli [TaxId:562] [51173] (6 PDB entries) |
Domain d1hv9b1: 1hv9 B:252-452 [28061] Other proteins in same PDB: d1hv9a2, d1hv9b2 complexed with co, coa, ud1 |
PDB Entry: 1hv9 (more details), 2.1 Å
SCOPe Domain Sequences for d1hv9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hv9b1 b.81.1.4 (B:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} vmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsvigddceisp ytvvedanlaaactigpfarlrpgaellegahvgnfvemkkarlgkgskaghltylgdae igdnvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvgkgatiaagttvtrnv genalaisrvpqtqkegwrrp
Timeline for d1hv9b1: