Lineage for d1hv9a1 (1hv9 A:252-452)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 470408Fold b.81: Single-stranded left-handed beta-helix [51160] (3 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 470409Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (6 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 470487Family b.81.1.4: N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51171] (1 protein)
    this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain
  6. 470488Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51172] (2 species)
  7. 470489Species Escherichia coli [TaxId:562] [51173] (3 PDB entries)
  8. 470490Domain d1hv9a1: 1hv9 A:252-452 [28060]
    Other proteins in same PDB: d1hv9a2, d1hv9b2

Details for d1hv9a1

PDB Entry: 1hv9 (more details), 2.1 Å

PDB Description: structure of e. coli glmu: analysis of pyrophosphorylase and acetyltransferase active sites

SCOP Domain Sequences for d1hv9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hv9a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli}
vmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsvigddceisp
ytvvedanlaaactigpfarlrpgaellegahvgnfvemkkarlgkgskaghltylgdae
igdnvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvgkgatiaagttvtrnv
genalaisrvpqtqkegwrrp

SCOP Domain Coordinates for d1hv9a1:

Click to download the PDB-style file with coordinates for d1hv9a1.
(The format of our PDB-style files is described here.)

Timeline for d1hv9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hv9a2