| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
| Protein automated matches [226903] (40 species) not a true protein |
| Species Yersinia pestis [TaxId:632] [280582] (5 PDB entries) |
| Domain d4zqia1: 4zqi A:1-96 [280591] Other proteins in same PDB: d4zqia2, d4zqib2, d4zqic2, d4zqid2 automated match to d1iowa1 complexed with na |
PDB Entry: 4zqi (more details), 2.3 Å
SCOPe Domain Sequences for d4zqia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zqia1 c.30.1.0 (A:1-96) automated matches {Yersinia pestis [TaxId: 632]}
maekvavllggtsaerevsllsgqavlaglkeagidaygvdtkdfpvtqlkeqgfdkvfi
alhgrggedgtlqgvleflqlpytgsgvmasaltmd
Timeline for d4zqia1: