![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
![]() | Protein automated matches [226904] (39 species) not a true protein |
![]() | Species Yersinia pestis [TaxId:632] [280584] (5 PDB entries) |
![]() | Domain d4zqid2: 4zqi D:97-306 [280587] Other proteins in same PDB: d4zqia1, d4zqib1, d4zqic1, d4zqid1 automated match to d1iova2 complexed with na |
PDB Entry: 4zqi (more details), 2.3 Å
SCOPe Domain Sequences for d4zqid2:
Sequence, based on SEQRES records: (download)
>d4zqid2 d.142.1.0 (D:97-306) automated matches {Yersinia pestis [TaxId: 632]} klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshegssvgmsk vdhaselqkalveafqhdsdvliekwlsgpeftvailgdevlpsiriqppgvfydydaky lsdktqyfcpsglsdeseqqlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspg mtshslvpmaarqyglsfsqlvarilmlad
>d4zqid2 d.142.1.0 (D:97-306) automated matches {Yersinia pestis [TaxId: 632]} klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshegvgmskvd haselqkalveafqhdsdvliekwlsgpeftvailgdevlpsiriqppgdktqyfcpsgl sdeseqqlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspgmtshslvpmaarq yglsfsqlvarilmlad
Timeline for d4zqid2: