Class b: All beta proteins [48724] (180 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins) this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain |
Protein Xenobiotic acetyltransferase [51169] (2 species) |
Species Pseudomonas aeruginosa [TaxId:287] [51170] (2 PDB entries) |
Domain d2xata_: 2xat A: [28058] complexed with clm, dca |
PDB Entry: 2xat (more details), 3.2 Å
SCOPe Domain Sequences for d2xata_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} nyfespfrgkllseqvsnpnirvgrysyysgyyhghsfddcarylmpdrddvdklvigsf csigsgaafimagnqghraewastfpfhfmheepafagavngyqpagdtlighevwigte amfmpgvrvghgaiigsralvtgdvepyaivggnpartirkrfsdgdiqnllemawwdwp ladieaampllctgdipalyqhwkqrqa
Timeline for d2xata_: