SCOPe 2.08: Domain d2xata_: 2xat A:

Lineage for d2xata_ (2xat A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins)
   this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain

6. Protein Xenobiotic acetyltransferase [51169] (2 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [51170] (2 PDB entries)

8. Domain d2xata_: 2xat A: [28058]
   complexed with clm, dca

Details for d2xata_

PDB Entry: 2xat, 3.2 Å

PDB Description: complex of the hexapeptide xenobiotic acetyltransferase with chloramphenicol and desulfo-coenzyme a

PDB Compounds: (A:) xenobiotic acetyltransferase

SCOPe Domain Sequences for d2xata_:

Sequence; same for both SEQRES and ATOM records:

>d2xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]}
nyfespfrgkllseqvsnpnirvgrysyysgyyhghsfddcarylmpdrddvdklvigsf
csigsgaafimagnqghraewastfpfhfmheepafagavngyqpagdtlighevwigte
amfmpgvrvghgaiigsralvtgdvepyaivggnpartirkrfsdgdiqnllemawwdwp
ladieaampllctgdipalyqhwkqrqa

Timeline for d2xata_:

• d2xata_ first appeared (with stable ids) in SCOP 1.55, called d2xat__
  
• d2xata_ appears in SCOPe 2.07