Lineage for d4zh1a1 (4zh1 A:3-294)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722506Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2722786Family a.102.4.4: Complement components [48251] (4 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 2722790Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species)
  7. 2722791Species Human (Homo sapiens) [TaxId:9606] [48253] (19 PDB entries)
  8. 2722801Domain d4zh1a1: 4zh1 A:3-294 [280572]
    Other proteins in same PDB: d4zh1a2
    automated match to d1ghqa_
    complexed with gol

Details for d4zh1a1

PDB Entry: 4zh1 (more details), 2.24 Å

PDB Description: complement factor h in complex with the gm1 glycan
PDB Compounds: (A:) Complement C3

SCOPe Domain Sequences for d4zh1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zh1a1 a.102.4.4 (A:3-294) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]}
daerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytq
qlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpd
gvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdf
leanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveatsy
allallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap

SCOPe Domain Coordinates for d4zh1a1:

Click to download the PDB-style file with coordinates for d4zh1a1.
(The format of our PDB-style files is described here.)

Timeline for d4zh1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zh1a2