SCOPe 2.05: Domain d4yhkl2: 4yhk L:113-218

Lineage for d4yhkl2 (4yhk L:113-218)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)

8. Domain d4yhkl2: 4yhk L:113-218 [280560]
   automated match to d3aazb2
   complexed with 4cc, gol

Details for d4yhkl2

PDB Entry: 4yhk, 2.21 Å

PDB Description: reversal agent for dabigatran

PDB Compounds: (L:) aDabi-Fab2a light chain

SCOPe Domain Sequences for d4yhkl2:

Sequence; same for both SEQRES and ATOM records:

>d4yhkl2 b.1.1.0 (L:113-218) automated matches {Homo sapiens [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d4yhkl2:

• d4yhkl2 is new in SCOPe 2.05-stable
  
• d4yhkl2 appears in SCOPe 2.06
  
• d4yhkl2 appears in the current release, SCOPe 2.08