SCOPe 2.08: Domain d4z6al2: 4z6a L:87-143

Lineage for d4z6al2 (4z6a L:87-143)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d4z6al2: 4z6a L:87-143 [280558]
   Other proteins in same PDB: d4z6ah_
   automated match to d2a2ql2
   complexed with 0z6, bgc, ca, cit, fuc

Details for d4z6al2

PDB Entry: 4z6a, 2.25 Å

PDB Description: crystal structure of a fviia-trypsin chimera (yt) in complex with soluble tissue factor

PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d4z6al2:

Sequence, based on SEQRES records:

>d4z6al2 g.3.11.1 (L:87-143) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilek

Sequence, based on observed residues (ATOM records):

>d4z6al2 g.3.11.1 (L:87-143) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtkrscrchegyslladgvsctptveypcgkipilek

Timeline for d4z6al2:

• d4z6al2 first appeared in SCOPe 2.05
  
• d4z6al2 appears in SCOPe 2.07