Lineage for d1tdta_ (1tdt A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403213Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2403214Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2403226Family b.81.1.2: Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD [51165] (2 protein domains)
    contains extra N-terminal 3-helical domain
  6. 2403227Protein Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD [51166] (3 species)
  7. 2403235Species Mycobacterium bovis [TaxId:1765] [51167] (5 PDB entries)
  8. 2403238Domain d1tdta_: 1tdt A: [28055]

Details for d1tdta_

PDB Entry: 1tdt (more details), 2.2 Å

PDB Description: three-dimensional structure of tetrahydrodipicolinate-n-succinlytransferase
PDB Compounds: (A:) tetrahydrodipicolinate-n-succinlytransferase

SCOPe Domain Sequences for d1tdta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]}
mqqlqnviesaferraditpanvdtvtreavnqviglldsgalrvaekidgqwvthqwlk
kavllsfrindnkvmdgaetryydkvpmkfadydearfqkegfrvvppatvrqgafiarn
tvlmpsyvnigayvdegtmvdtwatvgscaqigknvhlsggvgiggvleplqanptiied
ncfigarsevvegviveegsvismgvylgqstriydretgeihygrvpagsvvvsgnlps
kdgsyslycavivkkv

SCOPe Domain Coordinates for d1tdta_:

Click to download the PDB-style file with coordinates for d1tdta_.
(The format of our PDB-style files is described here.)

Timeline for d1tdta_: