SCOPe 2.05: Domain d4z22a_: 4z22 A:

Lineage for d4z22a_ (4z22 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)

7. Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (22 PDB entries)

8. Domain d4z22a_: 4z22 A: [280549]
   automated match to d1leea_
   complexed with 4kg

Details for d4z22a_

PDB Entry: 4z22, 2.62 Å

PDB Description: structure of plasmepsin ii from plasmodium falciparum complexed with inhibitor dr718a

PDB Compounds: (A:) Plasmepsin-2

SCOPe Domain Sequences for d4z22a_:

Sequence; same for both SEQRES and ATOM records:

>d4z22a_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
pltyeklnhdlywqitldahvgnislekancivdsgtsaitvptdflnkmlqnldvikvp
flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
lgdpfmrkyftvfdydnhsvgialakknl

Timeline for d4z22a_:

• d4z22a_ is new in SCOPe 2.05-stable
  
• d4z22a_ appears in SCOPe 2.06
  
• d4z22a_ appears in the current release, SCOPe 2.08