Class b: All beta proteins [48724] (176 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species) |
Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (22 PDB entries) |
Domain d4z22a_: 4z22 A: [280549] automated match to d1leea_ complexed with 4kg |
PDB Entry: 4z22 (more details), 2.62 Å
SCOPe Domain Sequences for d4z22a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z22a_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg pltyeklnhdlywqitldahvgnislekancivdsgtsaitvptdflnkmlqnldvikvp flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi lgdpfmrkyftvfdydnhsvgialakknl
Timeline for d4z22a_: