Lineage for d4ylqt1 (4ylq T:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761786Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 2761787Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
    Uniprot P13726 33-242
  8. 2761790Domain d4ylqt1: 4ylq T:1-106 [280547]
    Other proteins in same PDB: d4ylqh_, d4ylql1, d4ylql2, d4ylql3
    automated match to d1boya1
    complexed with 0z7, ca, fuc, pol, tma

Details for d4ylqt1

PDB Entry: 4ylq (more details), 1.4 Å

PDB Description: crystal structure of a fviia-trypsin chimera (ft) in complex with soluble tissue factor
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d4ylqt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ylqt1 b.1.2.1 (T:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt
deivkdvkqtylarvfsypagnvestgsageplyenspeftpylet

SCOPe Domain Coordinates for d4ylqt1:

Click to download the PDB-style file with coordinates for d4ylqt1.
(The format of our PDB-style files is described here.)

Timeline for d4ylqt1: