SCOPe 2.08: Domain d4yipc1: 4yip C:1-89

Lineage for d4yipc1 (4yip C:1-89)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (39 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:1309] [280537] (1 PDB entry)

8. Domain d4yipc1: 4yip C:1-89 [280543]
   Other proteins in same PDB: d4yipa2, d4yipa3, d4yipb2, d4yipb3, d4yipc2, d4yipd2, d4yipd3
   automated match to d3h1sb1
   complexed with fe

Details for d4yipc1

PDB Entry: 4yip, 2.15 Å

PDB Description: x-ray structure of the iron/manganese cambialistic superoxide dismutase from streptococcus mutans

PDB Compounds: (C:) Superoxide dismutase [Mn/Fe]

SCOPe Domain Sequences for d4yipc1:

Sequence; same for both SEQRES and ATOM records:

>d4yipc1 a.2.11.0 (C:1-89) automated matches {Streptococcus mutans [TaxId: 1309]}
aillpdlpyaydalepyidaetmtlhhdkhhatyvananaalekhpeigenlevlladve
qipadirqslinnggghlnhalfwellsp

Timeline for d4yipc1:

• d4yipc1 first appeared in SCOPe 2.05
  
• d4yipc1 appears in SCOPe 2.07