Lineage for d4yipd2 (4yip D:90-201)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946548Species Streptococcus mutans [TaxId:1309] [280539] (1 PDB entry)
  8. 2946552Domain d4yipd2: 4yip D:90-201 [280542]
    Other proteins in same PDB: d4yipa1, d4yipa3, d4yipb1, d4yipb3, d4yipc1, d4yipd1, d4yipd3
    automated match to d3h1sb2
    complexed with fe

Details for d4yipd2

PDB Entry: 4yip (more details), 2.15 Å

PDB Description: x-ray structure of the iron/manganese cambialistic superoxide dismutase from streptococcus mutans
PDB Compounds: (D:) Superoxide dismutase [Mn/Fe]

SCOPe Domain Sequences for d4yipd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yipd2 d.44.1.0 (D:90-201) automated matches {Streptococcus mutans [TaxId: 1309]}
ektkvtaevaaaineafgsfddfkaaftaaattrfgsgwawlvvdkegklevtstanqdt
pisqglkpilaldvwehayylnyrnvrpnyikaffevinwntvarlyaealt

SCOPe Domain Coordinates for d4yipd2:

Click to download the PDB-style file with coordinates for d4yipd2.
(The format of our PDB-style files is described here.)

Timeline for d4yipd2: