SCOPe 2.05: Domain d4yipd1: 4yip D:1-89

Lineage for d4yipd1 (4yip D:1-89)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (31 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:1309] [280537] (1 PDB entry)

8. Domain d4yipd1: 4yip D:1-89 [280541]
   Other proteins in same PDB: d4yipa2, d4yipb2, d4yipc2, d4yipd2
   automated match to d3h1sb1
   complexed with fe

Details for d4yipd1

PDB Entry: 4yip, 2.15 Å

PDB Description: x-ray structure of the iron/manganese cambialistic superoxide dismutase from streptococcus mutans

PDB Compounds: (D:) Superoxide dismutase [Mn/Fe]

SCOPe Domain Sequences for d4yipd1:

Sequence; same for both SEQRES and ATOM records:

>d4yipd1 a.2.11.0 (D:1-89) automated matches {Streptococcus mutans [TaxId: 1309]}
aillpdlpyaydalepyidaetmtlhhdkhhatyvananaalekhpeigenlevlladve
qipadirqslinnggghlnhalfwellsp

Timeline for d4yipd1:

• d4yipd1 is new in SCOPe 2.05-stable
  
• d4yipd1 appears in SCOPe 2.06
  
• d4yipd1 appears in the current release, SCOPe 2.08