Lineage for d4yipd1 (4yip D:1-89)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690595Species Streptococcus mutans [TaxId:1309] [280537] (1 PDB entry)
  8. 2690599Domain d4yipd1: 4yip D:1-89 [280541]
    Other proteins in same PDB: d4yipa2, d4yipa3, d4yipb2, d4yipb3, d4yipc2, d4yipd2, d4yipd3
    automated match to d3h1sb1
    complexed with fe

Details for d4yipd1

PDB Entry: 4yip (more details), 2.15 Å

PDB Description: x-ray structure of the iron/manganese cambialistic superoxide dismutase from streptococcus mutans
PDB Compounds: (D:) Superoxide dismutase [Mn/Fe]

SCOPe Domain Sequences for d4yipd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yipd1 a.2.11.0 (D:1-89) automated matches {Streptococcus mutans [TaxId: 1309]}
aillpdlpyaydalepyidaetmtlhhdkhhatyvananaalekhpeigenlevlladve
qipadirqslinnggghlnhalfwellsp

SCOPe Domain Coordinates for d4yipd1:

Click to download the PDB-style file with coordinates for d4yipd1.
(The format of our PDB-style files is described here.)

Timeline for d4yipd1: