| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
| Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
| Protein automated matches [226859] (39 species) not a true protein |
| Species Streptococcus mutans [TaxId:1309] [280537] (1 PDB entry) |
| Domain d4yipd1: 4yip D:1-89 [280541] Other proteins in same PDB: d4yipa2, d4yipa3, d4yipb2, d4yipb3, d4yipc2, d4yipd2, d4yipd3 automated match to d3h1sb1 complexed with fe |
PDB Entry: 4yip (more details), 2.15 Å
SCOPe Domain Sequences for d4yipd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yipd1 a.2.11.0 (D:1-89) automated matches {Streptococcus mutans [TaxId: 1309]}
aillpdlpyaydalepyidaetmtlhhdkhhatyvananaalekhpeigenlevlladve
qipadirqslinnggghlnhalfwellsp
Timeline for d4yipd1: