SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4yi0c_ (4yi0 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006377Protein Importin alpha [48376] (1 species)
  7. 2006378Species Mouse (Mus musculus) [TaxId:10090] [48377] (29 PDB entries)
  8. 2006388Domain d4yi0c_: 4yi0 C: [280536]
    automated match to d1pjmb_

Details for d4yi0c_

PDB Entry: 4yi0 (more details), 1.81 Å

PDB Description: structure of mouse importin a1 bound to pom121nls
PDB Compounds: (C:) Importin subunit alpha-1

SCOPe Domain Sequences for d4yi0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yi0c_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]}
tvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgktd
cspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniagd
gsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveqi
lptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivtp
alraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqq
vvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsak
dtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnli
ekyfs

SCOPe Domain Coordinates for d4yi0c_:

Click to download the PDB-style file with coordinates for d4yi0c_.
(The format of our PDB-style files is described here.)

Timeline for d4yi0c_: