Lineage for d4yiob1 (4yio B:1-89)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303511Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2303798Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2303799Protein automated matches [226859] (38 species)
    not a true protein
  7. 2304059Species Streptococcus thermophilus [TaxId:1308] [280527] (1 PDB entry)
  8. 2304061Domain d4yiob1: 4yio B:1-89 [280534]
    Other proteins in same PDB: d4yioa2, d4yioa3, d4yiob2, d4yiob3
    automated match to d2awpa1
    complexed with fe, gol, so4

Details for d4yiob1

PDB Entry: 4yio (more details), 1.6 Å

PDB Description: x-ray structure of the iron/manganese cambialistic superoxide dismutase from streptococcus thermophilus
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d4yiob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yiob1 a.2.11.0 (B:1-89) automated matches {Streptococcus thermophilus [TaxId: 1308]}
aiilpdlpyaydalepyidaetmtlhhdkhhatyvananaalekhpeigedlealladve
kipadirqalinnggghlnhalfwellsp

SCOPe Domain Coordinates for d4yiob1:

Click to download the PDB-style file with coordinates for d4yiob1.
(The format of our PDB-style files is described here.)

Timeline for d4yiob1: