Class a: All alpha proteins [46456] (286 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (31 species) not a true protein |
Species Streptococcus thermophilus [TaxId:1308] [280527] (1 PDB entry) |
Domain d4yiob1: 4yio B:1-89 [280534] Other proteins in same PDB: d4yioa2, d4yiob2 automated match to d2awpa1 complexed with fe, gol, so4 |
PDB Entry: 4yio (more details), 1.6 Å
SCOPe Domain Sequences for d4yiob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yiob1 a.2.11.0 (B:1-89) automated matches {Streptococcus thermophilus [TaxId: 1308]} aiilpdlpyaydalepyidaetmtlhhdkhhatyvananaalekhpeigedlealladve kipadirqalinnggghlnhalfwellsp
Timeline for d4yiob1: