![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
![]() | Protein automated matches [226859] (39 species) not a true protein |
![]() | Species Streptococcus thermophilus [TaxId:1308] [280527] (1 PDB entry) |
![]() | Domain d4yiob1: 4yio B:1-89 [280534] Other proteins in same PDB: d4yioa2, d4yioa3, d4yiob2, d4yiob3 automated match to d2awpa1 complexed with fe, gol, so4 |
PDB Entry: 4yio (more details), 1.6 Å
SCOPe Domain Sequences for d4yiob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yiob1 a.2.11.0 (B:1-89) automated matches {Streptococcus thermophilus [TaxId: 1308]} aiilpdlpyaydalepyidaetmtlhhdkhhatyvananaalekhpeigedlealladve kipadirqalinnggghlnhalfwellsp
Timeline for d4yiob1: