Lineage for d4yioa2 (4yio A:90-199)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552893Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2552894Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2553188Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2553189Protein automated matches [226860] (37 species)
    not a true protein
  7. 2553442Species Streptococcus thermophilus [TaxId:1308] [280529] (1 PDB entry)
  8. 2553443Domain d4yioa2: 4yio A:90-199 [280530]
    Other proteins in same PDB: d4yioa1, d4yioa3, d4yiob1, d4yiob3
    automated match to d2awpa2
    complexed with fe, gol, so4

Details for d4yioa2

PDB Entry: 4yio (more details), 1.6 Å

PDB Description: x-ray structure of the iron/manganese cambialistic superoxide dismutase from streptococcus thermophilus
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d4yioa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yioa2 d.44.1.0 (A:90-199) automated matches {Streptococcus thermophilus [TaxId: 1308]}
ekqeptaevaaaineafgsfeafqevfttsattrfgsgwawlvvnaegklevvstpnqdt
pisdgkkpilaldvwehayylkyrnvrpnyikaffeiinwnkvaelyaea

SCOPe Domain Coordinates for d4yioa2:

Click to download the PDB-style file with coordinates for d4yioa2.
(The format of our PDB-style files is described here.)

Timeline for d4yioa2: