Lineage for d4yioa2 (4yio A:90-202)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903583Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1903584Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1903858Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 1903859Protein automated matches [226860] (30 species)
    not a true protein
  7. 1904003Species Streptococcus thermophilus [TaxId:1308] [280529] (1 PDB entry)
  8. 1904004Domain d4yioa2: 4yio A:90-202 [280530]
    Other proteins in same PDB: d4yioa1, d4yiob1
    automated match to d2awpa2
    complexed with fe, gol, so4

Details for d4yioa2

PDB Entry: 4yio (more details), 1.6 Å

PDB Description: x-ray structure of the iron/manganese cambialistic superoxide dismutase from streptococcus thermophilus
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d4yioa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yioa2 d.44.1.0 (A:90-202) automated matches {Streptococcus thermophilus [TaxId: 1308]}
ekqeptaevaaaineafgsfeafqevfttsattrfgsgwawlvvnaegklevvstpnqdt
pisdgkkpilaldvwehayylkyrnvrpnyikaffeiinwnkvaelyaealeh

SCOPe Domain Coordinates for d4yioa2:

Click to download the PDB-style file with coordinates for d4yioa2.
(The format of our PDB-style files is described here.)

Timeline for d4yioa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4yioa1