SCOPe 2.08: Domain d4yioa1: 4yio A:1-89

Lineage for d4yioa1 (4yio A:1-89)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (39 species)
   not a true protein

7. Species Streptococcus thermophilus [TaxId:1308] [280527] (1 PDB entry)

8. Domain d4yioa1: 4yio A:1-89 [280528]
   Other proteins in same PDB: d4yioa2, d4yioa3, d4yiob2, d4yiob3
   automated match to d2awpa1
   complexed with fe, gol, so4

Details for d4yioa1

PDB Entry: 4yio, 1.6 Å

PDB Description: x-ray structure of the iron/manganese cambialistic superoxide dismutase from streptococcus thermophilus

PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d4yioa1:

Sequence; same for both SEQRES and ATOM records:

>d4yioa1 a.2.11.0 (A:1-89) automated matches {Streptococcus thermophilus [TaxId: 1308]}
aiilpdlpyaydalepyidaetmtlhhdkhhatyvananaalekhpeigedlealladve
kipadirqalinnggghlnhalfwellsp

Timeline for d4yioa1:

• d4yioa1 first appeared in SCOPe 2.05
  
• d4yioa1 appears in SCOPe 2.07