![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.81: Single-stranded left-handed beta-helix [51160] (3 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
![]() | Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (7 families) ![]() superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
![]() | Family b.81.1.1: UDP N-acetylglucosamine acyltransferase [51162] (1 protein) this is a repeat family; one repeat unit is 2jf2 A:59-89 found in domain |
![]() | Protein UDP N-acetylglucosamine acyltransferase [51163] (2 species) |
![]() | Species Escherichia coli, gene lpxA [TaxId:562] [51164] (4 PDB entries) |
![]() | Domain d1lxaa_: 1lxa A: [28052] mutant |
PDB Entry: 1lxa (more details), 2.6 Å
SCOP Domain Sequences for d1lxaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lxaa_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} midksafvhptaiveegasiganahigpfcivgphveigegtvlkshvvvnghtkigrdn eiyqfasigevnqdlkyageptrveigdrnriresvtihrgtvqgggltkvgsdnllmin ahiahdctvgnrcilannatlaghvsvddfaiiggmtavhqfciigahvmvggcsgvaqd vppyviaqgnhatpfgvnieglkrrgfsreaitairnaykliyrsgktldevkpeiaela etypevkaftdffarstrglir
Timeline for d1lxaa_: