Class b: All beta proteins [48724] (149 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (3 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (6 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.1: UDP N-acetylglucosamine acyltransferase [51162] (1 protein) this is a repeat family; one repeat unit is 2jf2 A:59-89 found in domain |
Protein UDP N-acetylglucosamine acyltransferase [51163] (2 species) |
Species Escherichia coli, gene lpxA [TaxId:562] [51164] (1 PDB entry) |
Domain d1lxa__: 1lxa - [28052] mutant |
PDB Entry: 1lxa (more details), 2.6 Å
SCOP Domain Sequences for d1lxa__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lxa__ b.81.1.1 (-) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA} midksafvhptaiveegasiganahigpfcivgphveigegtvlkshvvvnghtkigrdn eiyqfasigevnqdlkyageptrveigdrnriresvtihrgtvqgggltkvgsdnllmin ahiahdctvgnrcilannatlaghvsvddfaiiggmtavhqfciigahvmvggcsgvaqd vppyviaqgnhatpfgvnieglkrrgfsreaitairnaykliyrsgktldevkpeiaela etypevkaftdffarstrglir
Timeline for d1lxa__: