Lineage for d1lxa__ (1lxa -)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 470408Fold b.81: Single-stranded left-handed beta-helix [51160] (3 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 470409Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (6 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 470410Family b.81.1.1: UDP N-acetylglucosamine acyltransferase [51162] (1 protein)
    this is a repeat family; one repeat unit is 2jf2 A:59-89 found in domain
  6. 470411Protein UDP N-acetylglucosamine acyltransferase [51163] (2 species)
  7. 470412Species Escherichia coli, gene lpxA [TaxId:562] [51164] (1 PDB entry)
  8. 470413Domain d1lxa__: 1lxa - [28052]

Details for d1lxa__

PDB Entry: 1lxa (more details), 2.6 Å

PDB Description: udp n-acetylglucosamine acyltransferase

SCOP Domain Sequences for d1lxa__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxa__ b.81.1.1 (-) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA}
midksafvhptaiveegasiganahigpfcivgphveigegtvlkshvvvnghtkigrdn
eiyqfasigevnqdlkyageptrveigdrnriresvtihrgtvqgggltkvgsdnllmin
ahiahdctvgnrcilannatlaghvsvddfaiiggmtavhqfciigahvmvggcsgvaqd
vppyviaqgnhatpfgvnieglkrrgfsreaitairnaykliyrsgktldevkpeiaela
etypevkaftdffarstrglir

SCOP Domain Coordinates for d1lxa__:

Click to download the PDB-style file with coordinates for d1lxa__.
(The format of our PDB-style files is described here.)

Timeline for d1lxa__: