SCOP 1.67: Domain d1lxa__: 1lxa -

Lineage for d1lxa__ (1lxa -)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (3 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (5 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.1: UDP N-acetylglucosamine acyltransferase [51162] (1 protein)
   this is a repeat family; one repeat unit is 2jf2 A:59-89 found in domain

6. Protein UDP N-acetylglucosamine acyltransferase [51163] (2 species)

7. Species Escherichia coli, gene lpxA [TaxId:562] [51164] (1 PDB entry)

8. Domain d1lxa__: 1lxa - [28052]
   mutant

Details for d1lxa__

PDB Entry: 1lxa, 2.6 Å

PDB Description: udp n-acetylglucosamine acyltransferase

SCOP Domain Sequences for d1lxa__:

Sequence; same for both SEQRES and ATOM records:

>d1lxa__ b.81.1.1 (-) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA}
midksafvhptaiveegasiganahigpfcivgphveigegtvlkshvvvnghtkigrdn
eiyqfasigevnqdlkyageptrveigdrnriresvtihrgtvqgggltkvgsdnllmin
ahiahdctvgnrcilannatlaghvsvddfaiiggmtavhqfciigahvmvggcsgvaqd
vppyviaqgnhatpfgvnieglkrrgfsreaitairnaykliyrsgktldevkpeiaela
etypevkaftdffarstrglir

Timeline for d1lxa__:

• d1lxa__ first appeared (with stable ids) in SCOP 1.55
  
• d1lxa__ appears in SCOP 1.65
  
• d1lxa__ appears in SCOP 1.69
  
• d1lxa__ appears in the current release, SCOPe 2.08, called d1lxaa_