| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
| Protein automated matches [190590] (26 species) not a true protein |
| Species Nostoc sp. [TaxId:103690] [280510] (2 PDB entries) |
| Domain d4xxib_: 4xxi B: [280515] automated match to d4po5a_ complexed with cyc |
PDB Entry: 4xxi (more details), 2.2 Å
SCOPe Domain Sequences for d4xxib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xxib_ a.1.1.0 (B:) automated matches {Nostoc sp. [TaxId: 103690]}
lavatitqaeqqdrflgrgeldelasyfasgakrleiaqlltenseiivsraanrifqki
enmakslrdlswflryatyaivagdpniivvntrglreiienacsgeativalqeikaas
lsyfrkdpeaaeivsqymdvlitefk
Timeline for d4xxib_: