Lineage for d4xxib_ (4xxi B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1718504Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 1718505Protein automated matches [190590] (18 species)
    not a true protein
  7. 1718591Species Nostoc sp. [TaxId:103690] [280510] (2 PDB entries)
  8. 1718593Domain d4xxib_: 4xxi B: [280515]
    automated match to d4po5a_
    complexed with cyc

Details for d4xxib_

PDB Entry: 4xxi (more details), 2.2 Å

PDB Description: crystal structure of the bilin-binding domain of phycobilisome core- membrane linker apce
PDB Compounds: (B:) Phycobiliprotein ApcE

SCOPe Domain Sequences for d4xxib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xxib_ a.1.1.0 (B:) automated matches {Nostoc sp. [TaxId: 103690]}
lavatitqaeqqdrflgrgeldelasyfasgakrleiaqlltenseiivsraanrifqki
enmakslrdlswflryatyaivagdpniivvntrglreiienacsgeativalqeikaas
lsyfrkdpeaaeivsqymdvlitefk

SCOPe Domain Coordinates for d4xxib_:

Click to download the PDB-style file with coordinates for d4xxib_.
(The format of our PDB-style files is described here.)

Timeline for d4xxib_: