Lineage for d4xxka1 (4xxk A:20-240)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689395Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2689396Protein automated matches [190590] (26 species)
    not a true protein
  7. 2689503Species Nostoc sp. [TaxId:103690] [280510] (2 PDB entries)
  8. 2689506Domain d4xxka1: 4xxk A:20-240 [280511]
    Other proteins in same PDB: d4xxka2
    automated match to d4po5a_
    complexed with cyc

Details for d4xxka1

PDB Entry: 4xxk (more details), 2.97 Å

PDB Description: crystal structure of the semet-derivative of the bilin-binding domain of phycobilisome core-membrane linker apce
PDB Compounds: (A:) Phycobiliprotein ApcE

SCOPe Domain Sequences for d4xxka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xxka1 a.1.1.0 (A:20-240) automated matches {Nostoc sp. [TaxId: 103690]}
lavatitqaeqqdrflgrgeldelasyfasgakrleiaqlltenseiivsraanrifqki
enmakslrdlswflryatyaivagdpniivvntrglreiienacsgeativalqeikaas
lsyfrkdpeaaeivsqymdvlitefkap

SCOPe Domain Coordinates for d4xxka1:

Click to download the PDB-style file with coordinates for d4xxka1.
(The format of our PDB-style files is described here.)

Timeline for d4xxka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xxka2
View in 3D
Domains from other chains:
(mouse over for more information)
d4xxkb_