![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
![]() | Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) ![]() bind purine or pterin in topologically similar sites between subunits |
![]() | Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins) automatically mapped to Pfam PF01014 |
![]() | Protein automated matches [254656] (3 species) not a true protein |
![]() | Species Bacillus tb-90 [TaxId:36824] [280497] (1 PDB entry) |
![]() | Domain d4xfpd1: 4xfp D:8-158 [280504] automated match to d1j2ga1 complexed with aza, cl, so4; mutant |
PDB Entry: 4xfp (more details), 1.66 Å
SCOPe Domain Sequences for d4xfpd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xfpd1 d.96.1.4 (D:8-158) automated matches {Bacillus tb-90 [TaxId: 36824]} vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa vkngnraaselvfkksrneyataylnmvrne
Timeline for d4xfpd1: