Lineage for d4xfpa1 (4xfp A:8-158)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966179Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2966180Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2966494Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
    automatically mapped to Pfam PF01014
  6. 2966729Protein automated matches [254656] (4 species)
    not a true protein
  7. 2966879Species Bacillus tb-90 [TaxId:36824] [280497] (1 PDB entry)
  8. 2966880Domain d4xfpa1: 4xfp A:8-158 [280502]
    automated match to d1j2ga1
    complexed with aza, cl, so4; mutant

Details for d4xfpa1

PDB Entry: 4xfp (more details), 1.66 Å

PDB Description: crystal structure of highly active mutant of bacillus sp. tb-90 urate oxidase
PDB Compounds: (A:) urate oxidase

SCOPe Domain Sequences for d4xfpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xfpa1 d.96.1.4 (A:8-158) automated matches {Bacillus tb-90 [TaxId: 36824]}
vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
vkngnraaselvfkksrneyataylnmvrne

SCOPe Domain Coordinates for d4xfpa1:

Click to download the PDB-style file with coordinates for d4xfpa1.
(The format of our PDB-style files is described here.)

Timeline for d4xfpa1: