Lineage for d1daba_ (1dab A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069178Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069179Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2069323Family b.80.1.7: Virulence factor P.69 pertactin [51153] (2 protein domains)
  6. 2069324Protein Virulence factor P.69 pertactin [51154] (1 species)
  7. 2069325Species Bordetella pertussis [TaxId:520] [51155] (1 PDB entry)
  8. 2069326Domain d1daba_: 1dab A: [28049]

Details for d1daba_

PDB Entry: 1dab (more details), 2.5 Å

PDB Description: the structure of bordetella pertussis virulence factor p.69 pertactin
PDB Compounds: (A:) p.69 pertactin

SCOPe Domain Sequences for d1daba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1daba_ b.80.1.7 (A:) Virulence factor P.69 pertactin {Bordetella pertussis [TaxId: 520]}
dwnnqsivktgerqhgihiqgsdpggvrtasgttikvsgrqaqgillenpaaelqfrngs
vtssgqlsddgirrflgtvtvkagklvadhatlanvgdtwdddgialyvageqaqasiad
stlqgaggvqierganvtvqrsaivdgglhigalqslqpedlppsrvvlrdtnvtavpas
gapaavsvlgaseltldgghitggraagvaamqgavvhlqratirrgdalaggavpggav
pggavpggfgpggfgpvldgwygvdvsgssvelaqsiveapelgaairvgrgarvtvpgg
slsaphgnvietggarrfapqaaplsitlqagahaqgkallyrvlpepvkltltggadaq
gdivatelpsipgtsigpldvalasqarwtgatravdslsidnatwvmtdnsnvgalrla
sdgsvdfqqpaeagrfkvltvntlagsglfrmnvfadlglsdklvvmqdasgqhrlwvrn
sgsepasantlllvqtplgsaatftlankdgkvdigtyryrlaangngqwslvgakapp

SCOPe Domain Coordinates for d1daba_:

Click to download the PDB-style file with coordinates for d1daba_.
(The format of our PDB-style files is described here.)

Timeline for d1daba_: