Lineage for d4xcsb_ (4xcs B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877880Protein automated matches [190100] (21 species)
    not a true protein
  7. 2878164Species Human (Homo sapiens) [TaxId:9606] [187259] (21 PDB entries)
  8. 2878220Domain d4xcsb_: 4xcs B: [280489]
    Other proteins in same PDB: d4xcsa2, d4xcsc2, d4xcsf2
    automated match to d3tkpc_
    complexed with cps, gol; mutant

Details for d4xcsb_

PDB Entry: 4xcs (more details), 2.1 Å

PDB Description: human peroxiredoxin-1 c83s mutant
PDB Compounds: (B:) Peroxiredoxin-1

SCOPe Domain Sequences for d4xcsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xcsb_ c.47.1.10 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gnakighpapnfkatavmpdgqfkdislsdykgkyvvfffypldftfvcpteiiafsdra
eefkklncqvigasvdshfshlawvntpkkqgglgpmniplvsdpkrtiaqdygvlkade
gisfrglfiiddkgilrqitvndlpvgrsvdetlrlvqafqftdkhgevcpagwkp

SCOPe Domain Coordinates for d4xcsb_:

Click to download the PDB-style file with coordinates for d4xcsb_.
(The format of our PDB-style files is described here.)

Timeline for d4xcsb_: