Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (21 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187259] (21 PDB entries) |
Domain d4xcsc1: 4xcs C:1-176 [280487] Other proteins in same PDB: d4xcsa2, d4xcsc2, d4xcsf2 automated match to d3tkpc_ complexed with cps, gol; mutant |
PDB Entry: 4xcs (more details), 2.1 Å
SCOPe Domain Sequences for d4xcsc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xcsc1 c.47.1.10 (C:1-176) automated matches {Human (Homo sapiens) [TaxId: 9606]} mssgnakighpapnfkatavmpdgqfkdislsdykgkyvvfffypldftfvcpteiiafs draeefkklncqvigasvdshfshlawvntpkkqgglgpmniplvsdpkrtiaqdygvlk adegisfrglfiiddkgilrqitvndlpvgrsvdetlrlvqafqftdkhgevcpag
Timeline for d4xcsc1: