Lineage for d3x31a_ (3x31 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009359Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 2009360Species Human (Homo sapiens) [TaxId:9606] [48529] (28 PDB entries)
  8. 2009384Domain d3x31a_: 3x31 A: [280485]
    automated match to d1s19a_
    complexed with 41v

Details for d3x31a_

PDB Entry: 3x31 (more details), 2.11 Å

PDB Description: crystal structure of the human vitamin d receptor ligand binding domain complexed with 7,8-cis-14-epi-1a,25-dihydroxy-19-norvitamin d3
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d3x31a_:

Sequence, based on SEQRES records: (download)

>d3x31a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]}
dslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlp
hladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtc
gnqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqd
aalieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqp
ecsmkltplvlevfg

Sequence, based on observed residues (ATOM records): (download)

>d3x31a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]}
dslrpklseeqqriiailldahhktydptysdfcqfrppvrvndggsvtlelsqlsmlph
ladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcg
nqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqda
alieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpe
csmkltplvlevfg

SCOPe Domain Coordinates for d3x31a_:

Click to download the PDB-style file with coordinates for d3x31a_.
(The format of our PDB-style files is described here.)

Timeline for d3x31a_: