![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
![]() | Protein automated matches [190777] (28 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [267798] (11 PDB entries) |
![]() | Domain d4x5gb1: 4x5g B:1-159 [280481] Other proteins in same PDB: d4x5gb2 automated match to d3jw3a_ complexed with bme, fol, nap |
PDB Entry: 4x5g (more details), 1.9 Å
SCOPe Domain Sequences for d4x5gb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x5gb1 c.71.1.0 (B:1-159) automated matches {Escherichia coli [TaxId: 83333]} misliaalavdrvigmenampwnlpadlawfkrntlnkpvimgrhtwesigrplpgrkni ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve gdthfpdyepddwesvfsefhdadaqnshsycfeilerr
Timeline for d4x5gb1: